Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (28 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen alpha chain [88887] (4 species) |
Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88891] (2 PDB entries) |
Domain d1lwug_: 1lwu G: [74319] Other proteins in same PDB: d1lwub1, d1lwub2, d1lwuc1, d1lwuc2, d1lwue1, d1lwue2, d1lwuf1, d1lwuf2, d1lwuh1, d1lwuh2, d1lwui1, d1lwui2, d1lwuk1, d1lwuk2, d1lwul1, d1lwul2 |
PDB Entry: 1lwu (more details), 2.8 Å
SCOP Domain Sequences for d1lwug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lwug_ h.1.8.1 (G:) Fibrinogen alpha chain {Sea lamprey (Petromyzon marinus)} nelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrac kgscaryleyrldkeknlqlekaasyianlkferfeevv
Timeline for d1lwug_: