Lineage for d1lwug_ (1lwu G:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 271842Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 272214Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 272215Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 272216Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
    in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  7. 272298Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [75698] (2 PDB entries)
  8. 272305Domain d1lwug_: 1lwu G: [74319]
    Other proteins in same PDB: d1lwub1, d1lwuc1, d1lwue1, d1lwuf1, d1lwuh1, d1lwui1, d1lwuk1, d1lwul1

Details for d1lwug_

PDB Entry: 1lwu (more details), 2.8 Å

PDB Description: Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide

SCOP Domain Sequences for d1lwug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwug_ h.1.8.1 (G:) Fibrinogen coiled-coil and central regions {Sea lamprey (Petromyzon marinus)}
nelevrysevlrelerriihlqrrinmqlqqltllqhniktqvsqilrvevdidvalrac
kgscaryleyrldkeknlqlekaasyianlkferfeevv

SCOP Domain Coordinates for d1lwug_:

Click to download the PDB-style file with coordinates for d1lwug_.
(The format of our PDB-style files is described here.)

Timeline for d1lwug_: