Lineage for d1lwuc2 (1lwu C:83-137)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205391Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
  4. 205752Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 205753Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 205754Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
  7. 205812Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [75698] (1 PDB entry)
  8. 205815Domain d1lwuc2: 1lwu C:83-137 [74313]
    Other proteins in same PDB: d1lwub1, d1lwuc1, d1lwue1, d1lwuf1, d1lwuh1, d1lwui1, d1lwuk1, d1lwul1

Details for d1lwuc2

PDB Entry: 1lwu (more details), 2.8 Å

PDB Description: crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide

SCOP Domain Sequences for d1lwuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwuc2 h.1.8.1 (C:83-137) Fibrinogen coiled-coil and central regions {Sea lamprey (Petromyzon marinus)}
ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrp

SCOP Domain Coordinates for d1lwuc2:

Click to download the PDB-style file with coordinates for d1lwuc2.
(The format of our PDB-style files is described here.)

Timeline for d1lwuc2: