Lineage for d1lwuc1 (1lwu C:138-399)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560074Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2560075Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2560076Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 2560077Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 2560166Species Sea lamprey (Petromyzon marinus), gamma [TaxId:7757] [75589] (2 PDB entries)
  8. 2560167Domain d1lwuc1: 1lwu C:138-399 [74312]
    Other proteins in same PDB: d1lwua_, d1lwub2, d1lwuc2, d1lwud_, d1lwue2, d1lwuf2, d1lwug_, d1lwuh2, d1lwui2, d1lwuj_, d1lwuk2, d1lwul2
    complexed with bma, ca, gal, man, nag, ndg, nh2

Details for d1lwuc1

PDB Entry: 1lwu (more details), 2.8 Å

PDB Description: Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide
PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1lwuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwuc1 d.171.1.1 (C:138-399) Fibrinogen C-terminal domains {Sea lamprey (Petromyzon marinus), gamma [TaxId: 7757]}
cqdttankispitgkdcqqvvdnggkdsglyyikplkakqpflvfceiengngwtviqhr
hdgsvnftrdwvsyregfgylaptlttefwlgnekihlltgqqayrlridltdwenthry
adyghfkltpesdeyrlfysmyldgdagnafdgfdfgddpqdkfytthlgmlfstperdn
dkyegscaeqdgsgwwmnrchaghlngkyyfggnyrktdvefpyddgiiwatwhdrwysl
kmttmkllpmgrdlsghggqqq

SCOPe Domain Coordinates for d1lwuc1:

Click to download the PDB-style file with coordinates for d1lwuc1.
(The format of our PDB-style files is described here.)

Timeline for d1lwuc1: