SCOPe 2.03: Domain d1lwjb1: 1lwj B:833-882

Lineage for d1lwjb1 (1lwj B:833-882)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein 4-alpha-glucanotransferase [75018] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75019] (2 PDB entries)

8. Domain d1lwjb1: 1lwj B:833-882 [74305]
   Other proteins in same PDB: d1lwja2, d1lwjb2
   complexed with acg, ca

Details for d1lwjb1

PDB Entry: 1lwj, 2.5 Å

PDB Description: crystal structure of t. maritima 4-alpha-glucanotransferase/acarbose complex

PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1lwjb1:

Sequence; same for both SEQRES and ATOM records:

>d1lwjb1 b.71.1.1 (B:833-882) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]}
akleflckedkflvyrlyddqhslkvfhnlsgeevvfegvkmkpyktevv

Timeline for d1lwjb1:

• d1lwjb1 first appeared in SCOP 1.61
  
• d1lwjb1 appears in SCOPe 2.02
  
• d1lwjb1 appears in SCOPe 2.04
  
• d1lwjb1 appears in the current release, SCOPe 2.08