Lineage for d1lwja1 (1lwj A:392-441)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1327902Protein 4-alpha-glucanotransferase [75018] (1 species)
  7. 1327903Species Thermotoga maritima [TaxId:2336] [75019] (2 PDB entries)
  8. 1327906Domain d1lwja1: 1lwj A:392-441 [74303]
    Other proteins in same PDB: d1lwja2, d1lwjb2
    complexed with acg, ca

Details for d1lwja1

PDB Entry: 1lwj (more details), 2.5 Å

PDB Description: crystal structure of t. maritima 4-alpha-glucanotransferase/acarbose complex
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1lwja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwja1 b.71.1.1 (A:392-441) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]}
akleflckedkflvyrlyddqhslkvfhnlsgeevvfegvkmkpyktevv

SCOPe Domain Coordinates for d1lwja1:

Click to download the PDB-style file with coordinates for d1lwja1.
(The format of our PDB-style files is described here.)

Timeline for d1lwja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lwja2