Lineage for d1lwja1 (1lwj A:392-441)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 170930Protein 4-alpha-glucanotransferase [75018] (1 species)
  7. 170931Species Thermotoga maritima [TaxId:243274] [75019] (2 PDB entries)
  8. 170934Domain d1lwja1: 1lwj A:392-441 [74303]
    Other proteins in same PDB: d1lwja2, d1lwjb2

Details for d1lwja1

PDB Entry: 1lwj (more details), 2.5 Å

PDB Description: crystal structure of t. maritima 4-alpha-glucanotransferase/acarbose complex

SCOP Domain Sequences for d1lwja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwja1 b.71.1.1 (A:392-441) 4-alpha-glucanotransferase {Thermotoga maritima}
akleflckedkflvyrlyddqhslkvfhnlsgeevvfegvkmkpyktevv

SCOP Domain Coordinates for d1lwja1:

Click to download the PDB-style file with coordinates for d1lwja1.
(The format of our PDB-style files is described here.)

Timeline for d1lwja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lwja2