Lineage for d1lwhb2 (1lwh B:442-832)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339273Protein 4-alpha-glucanotransferase [75062] (1 species)
  7. 1339274Species Thermotoga maritima [TaxId:2336] [75063] (2 PDB entries)
  8. 1339276Domain d1lwhb2: 1lwh B:442-832 [74302]
    Other proteins in same PDB: d1lwha1, d1lwhb1
    complexed with ca

Details for d1lwhb2

PDB Entry: 1lwh (more details), 2.6 Å

PDB Description: crystal structure of t. maritima 4-alpha-glucanotransferase
PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1lwhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwhb2 c.1.8.1 (B:442-832) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]}
migyqiyvrsfrdgnldgvgdfrglknavsylkelgidfvwlmpvfssisfhgydvvdfy
sfkaeygserefkemieafhdsgikvvldlpihhtgflhtwfqkalkgdphyrdyyvwan
ketdlderrewdgekiwhpledgrfyrglfgpfspdlnydnpqvfdemkrlvlhlldmgv
dgfrfdaakhmrdtieqnvrfwkyflsdlkgiflaeiwaearmvdehgrifgymlnfdts
hcikeavwkentrvliesieraviakdylpvnftsnhdmsrlasfeggfskekiklsisi
lftlpgvplvfygdelgmkgvyqkpntevvldpfpwnesmcvegqtfwkwpayngpfsgi
sveyqkrdpdsilshtlgwtrfrkenqwidr

SCOPe Domain Coordinates for d1lwhb2:

Click to download the PDB-style file with coordinates for d1lwhb2.
(The format of our PDB-style files is described here.)

Timeline for d1lwhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lwhb1