Lineage for d1lvha_ (1lvh A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186865Fold c.108: HAD-like [56783] (1 superfamily)
  4. 186866Superfamily c.108.1: HAD-like [56784] (6 families) (S)
  5. 186935Family c.108.1.6: beta-Phosphoglucomutase [75173] (1 protein)
  6. 186936Protein beta-Phosphoglucomutase [75174] (1 species)
  7. 186937Species Lactococcus lactis [TaxId:1358] [75175] (1 PDB entry)
  8. 186938Domain d1lvha_: 1lvh A: [74282]

Details for d1lvha_

PDB Entry: 1lvh (more details), 2.3 Å

PDB Description: The Structure of Phosphorylated beta-phosphoglucomutase from Lactoccocus lactis to 2.3 angstrom resolution

SCOP Domain Sequences for d1lvha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvha_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk

SCOP Domain Coordinates for d1lvha_:

Click to download the PDB-style file with coordinates for d1lvha_.
(The format of our PDB-style files is described here.)

Timeline for d1lvha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lvhb_