SCOP 1.71: Domain d1lv1a2: 1lv1 A:1001-1099

Lineage for d1lv1a2 (1lv1 A:1001-1099)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (179 PDB entries)

8. Domain d1lv1a2: 1lv1 A:1001-1099 [74274]
   synthetic tethered dimer
   mutant

Details for d1lv1a2

PDB Entry: 1lv1, 2.1 Å

PDB Description: crystal structure analysis of the non-active site mutant of tethered hiv-1 protease to 2.1a resolution

SCOP Domain Sequences for d1lv1a2:

Sequence; same for both SEQRES and ATOM records:

>d1lv1a2 b.50.1.1 (A:1001-1099) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d1lv1a2:

• d1lv1a2 first appeared in SCOP 1.61
  
• d1lv1a2 appears in SCOP 1.69
  
• d1lv1a2 appears in SCOP 1.73
  
• d1lv1a2 appears in the current release, SCOPe 2.08