Lineage for d1luzb_ (1luz B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (15 proteins) 
Protein Viral structural mimic of eIF2alpha [74952] (2 species) Species Vaccinia virus [TaxId:10245] [74953] (1 PDB entry) 
Domain d1luzb_: 1luz B: [74272]
Details for d1luzb_
PDB Entry: 1luz (more details), 1.8 Å
PDB Description: Crystal Structure of the K3L Protein From Vaccinia Virus (Wisconsin Strain)
SCOP Domain Sequences for d1luzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1luzb_ b.40.4.5 (B:) Viral structural mimic of eIF2alpha {Vaccinia virus}
yslpnagdvikgrvyekdyalyiylfdyphfeailaesvkmhmdryveyrdklvgktvkv
kvirvdytkgyidvnykrmcrhq
SCOP Domain Coordinates for d1luzb_:
Click to download the PDB-style file with coordinates for d1luzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1luzb_:
- d1luzb_ is new in SCOP 1.61
- d1luzb_ appears in SCOP 1.63
- d1luzb_ appears in the current release, SCOPe 2.08
View in 3D
