SCOPe 2.01: Domain d1luza_: 1luz A:

Lineage for d1luza_ (1luz A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Viral structural mimic of eIF2alpha [74952] (2 species)

7. Species Vaccinia virus [TaxId:10245] [74953] (1 PDB entry)

8. Domain d1luza_: 1luz A: [74271]

Details for d1luza_

PDB Entry: 1luz, 1.8 Å

PDB Description: Crystal Structure of the K3L Protein From Vaccinia Virus (Wisconsin Strain)

PDB Compounds: (A:) Protein K3

SCOPe Domain Sequences for d1luza_:

Sequence; same for both SEQRES and ATOM records:

>d1luza_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Vaccinia virus [TaxId: 10245]}
fcyslpnagdvikgrvyekdyalyiylfdyphfeailaesvkmhmdryveyrdklvgktv
kvkvirvdytkgyidvnykrmcrhq

Timeline for d1luza_:

• d1luza_ first appeared in SCOP 1.61
  
• d1luza_ appears in SCOP 1.75
  
• d1luza_ appears in SCOPe 2.02
  
• d1luza_ appears in the current release, SCOPe 2.08