Class a: All alpha proteins [46456] (258 folds) |
Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [46619] (23 PDB entries) |
Domain d1luwb1: 1luw B:1-83 [74269] Other proteins in same PDB: d1luwa2, d1luwb2 complexed with mn, so4; mutant |
PDB Entry: 1luw (more details), 2.3 Å
SCOP Domain Sequences for d1luwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1luwb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} khslpdlpydygalephinaqimqlhhskqhaayvnnlnvteekyqealakgdvtaqial qpalkfnggghinhsifwtnlsp
Timeline for d1luwb1: