SCOP 1.61: Domain d1lshb1: 1lsh B:

Lineage for d1lshb1 (1lsh B:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.7: Lipovitellin-phosvitin complex; beta-sheet shell regions [56967] (1 superfamily)

4. Superfamily f.7.1: Lipovitellin-phosvitin complex; beta-sheet shell regions [56968] (1 family)

5. Family f.7.1.1: Lipovitellin-phosvitin complex; beta-sheet shell regions [56969] (1 protein)

6. Protein Lipovitellin-phosvitin complex; beta-sheet shell regions [56970] (1 species)

7. Species Lamprey (Ichthyomyzon unicuspis) [TaxId:30308] [56971] (1 PDB entry)

8. Domain d1lshb1: 1lsh B: [74245]
   Other proteins in same PDB: d1lsha1

Details for d1lshb1

PDB Entry: 1lsh, 1.9 Å

PDB Description: lipid-protein interactions in lipovitellin

SCOP Domain Sequences for d1lshb1:

Sequence; same for both SEQRES and ATOM records:

>d1lshb1 f.7.1.1 (B:) Lipovitellin-phosvitin complex; beta-sheet shell regions {Lamprey (Ichthyomyzon unicuspis)}
skpkvvivlravradgkqqglqttlyygltsnglpkakivavelsdlsvwklcakfrlsa
hmkakaaigwgkncqqyramleastgnlqshpaarvdikwgrlpsslqraknallengap
viasklemeimpkanqkhqvsvilaamtprrmniivklpkvtyfqqgillpftf

Timeline for d1lshb1:

• d1lshb1 is new in SCOP 1.61
  
• d1lshb1 is called d1lshb_ in SCOP 1.63
  
• d1lshb1 appears in the current release, SCOPe 2.08, called d1lshb_