Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.7: Lipovitellin-phosvitin complex; beta-sheet shell regions [56967] (1 superfamily) contains several large open beta-sheets |
Superfamily f.7.1: Lipovitellin-phosvitin complex; beta-sheet shell regions [56968] (1 family) |
Family f.7.1.1: Lipovitellin-phosvitin complex; beta-sheet shell regions [56969] (1 protein) |
Protein Lipovitellin-phosvitin complex; beta-sheet shell regions [56970] (1 species) |
Species Lamprey (Ichthyomyzon unicuspis) [TaxId:30308] [56971] (1 PDB entry) |
Domain d1lshb_: 1lsh B: [74245] Other proteins in same PDB: d1lsha1 complexed with pld, upl |
PDB Entry: 1lsh (more details), 1.9 Å
SCOPe Domain Sequences for d1lshb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lshb_ f.7.1.1 (B:) Lipovitellin-phosvitin complex; beta-sheet shell regions {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} skpkvvivlravradgkqqglqttlyygltsnglpkakivavelsdlsvwklcakfrlsa hmkakaaigwgkncqqyramleastgnlqshpaarvdikwgrlpsslqraknallengap viasklemeimpkanqkhqvsvilaamtprrmniivklpkvtyfqqgillpftf
Timeline for d1lshb_: