Lineage for d1ls2a_ (1ls2 A:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1710427Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1710619Domain d1ls2a_: 1ls2 A: [74238]
    Fitting of EF-TU and tRNA in the cryo-EM map
    protein/RNA complex

Details for d1ls2a_

PDB Entry: 1ls2 (more details), 16.8 Å

PDB Description: fitting of ef-tu and trna in the low resolution cryo-em map of an ef- tu ternary complex (gdp and kirromycin) bound to e. coli 70s ribosome
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1ls2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ls2a_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgi
ketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfese
vyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpia
mddglrfaireggrtvgagvvakvls

SCOPe Domain Coordinates for d1ls2a_:

Click to download the PDB-style file with coordinates for d1ls2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ls2a_: