Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fc (human) IgE [49121] (3 PDB entries) |
Domain d1ls0a3: 1ls0 A:439-545 [74234] |
PDB Entry: 1ls0 (more details), 2.6 Å
SCOP Domain Sequences for d1ls0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ls0a3 b.1.1.2 (A:439-545) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE} praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp
Timeline for d1ls0a3: