Lineage for d1ls0a3 (1ls0 A:439-545)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 160037Species Fc (human) IgE [49121] (3 PDB entries)
  8. 160042Domain d1ls0a3: 1ls0 A:439-545 [74234]

Details for d1ls0a3

PDB Entry: 1ls0 (more details), 2.6 Å

PDB Description: The crystal structure of IgE Fc reveals an asymmetrically bent conformation

SCOP Domain Sequences for d1ls0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ls0a3 b.1.1.2 (A:439-545) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgE}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

SCOP Domain Coordinates for d1ls0a3:

Click to download the PDB-style file with coordinates for d1ls0a3.
(The format of our PDB-style files is described here.)

Timeline for d1ls0a3:

  • d1ls0a3 is new in SCOP 1.61
  • d1ls0a3 does not appear in SCOP 1.63