SCOP 1.75: Domain d1lrhc_: 1lrh C:

Lineage for d1lrhc_ (1lrh C:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Auxin binding protein [75030] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [75031] (2 PDB entries)

8. Domain d1lrhc_: 1lrh C: [74221]

Details for d1lrhc_

PDB Entry: 1lrh, 1.9 Å

PDB Description: crystal structure of auxin-binding protein 1 in complex with 1- naphthalene acetic acid

PDB Compounds: (C:) auxin-binding protein 1

SCOP Domain Sequences for d1lrhc_:

Sequence; same for both SEQRES and ATOM records:

>d1lrhc_ b.82.1.2 (C:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]}
scvrdnslvrdisqmpqssygieglshitvagalnhgmkevevwlqtispgqrtpihrhs
ceevftvlkgkgtllmgssslkypgqpqeipffqnttfsipvndphqvwnsdehedlqvl
viisrppakiflyddwsmphtaavlkfpfvwdedcfeaak

Timeline for d1lrhc_:

• d1lrhc_ first appeared in SCOP 1.61
  
• d1lrhc_ appears in SCOP 1.73
  
• d1lrhc_ appears in SCOPe 2.01
  
• d1lrhc_ appears in the current release, SCOPe 2.08