![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Endothelial protein C receptor [75381] (1 species) phospholipid-binding protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75382] (4 PDB entries) |
![]() | Domain d1lqvb_: 1lqv B: [74207] Other proteins in same PDB: d1lqvc_, d1lqvd_ complexed with a phospholipid molecule and GLA domain of protein C complexed with ca, nag, ndg, pty |
PDB Entry: 1lqv (more details), 1.6 Å
SCOPe Domain Sequences for d1lqvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqvb_ d.19.1.1 (B:) Endothelial protein C receptor {Human (Homo sapiens) [TaxId: 9606]} lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae
Timeline for d1lqvb_: