SCOP 1.61: Domain d1lqvb_: 1lqv B:

Lineage for d1lqvb_ (1lqv B:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein Endothelial protein C receptor [75381] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75382] (2 PDB entries)

8. Domain d1lqvb_: 1lqv B: [74207]
   Other proteins in same PDB: d1lqvc_, d1lqvd_

Details for d1lqvb_

PDB Entry: 1lqv, 1.6 Å

PDB Description: crystal structure of the endothelial protein c receptor with phospholipid in the groove in complex with gla domain of protein c.

SCOP Domain Sequences for d1lqvb_:

Sequence; same for both SEQRES and ATOM records:

>d1lqvb_ d.19.1.1 (B:) Endothelial protein C receptor {Human (Homo sapiens)}
lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs
glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr
peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae

Timeline for d1lqvb_:

• d1lqvb_ is new in SCOP 1.61
  
• d1lqvb_ appears in SCOP 1.63
  
• d1lqvb_ appears in the current release, SCOPe 2.08