SCOP 1.65: Domain d1lqva_: 1lqv A:

Lineage for d1lqva_ (1lqv A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Endothelial protein C receptor [75381] (1 species)
   phospholipid-binding protein

7. Species Human (Homo sapiens) [TaxId:9606] [75382] (2 PDB entries)

8. Domain d1lqva_: 1lqv A: [74206]
   Other proteins in same PDB: d1lqvc_, d1lqvd_

Details for d1lqva_

PDB Entry: 1lqv, 1.6 Å

PDB Description: crystal structure of the endothelial protein c receptor with phospholipid in the groove in complex with gla domain of protein c.

SCOP Domain Sequences for d1lqva_:

Sequence; same for both SEQRES and ATOM records:

>d1lqva_ d.19.1.1 (A:) Endothelial protein C receptor {Human (Homo sapiens)}
glqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartq
sglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsf
rperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhis

Timeline for d1lqva_:

• d1lqva_ first appeared in SCOP 1.61
  
• d1lqva_ appears in SCOP 1.63
  
• d1lqva_ appears in SCOP 1.67
  
• d1lqva_ appears in the current release, SCOPe 2.08