![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
![]() | Protein Endothelial protein C receptor [75381] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75382] (2 PDB entries) |
![]() | Domain d1lqva_: 1lqv A: [74206] Other proteins in same PDB: d1lqvc_, d1lqvd_ |
PDB Entry: 1lqv (more details), 1.6 Å
SCOP Domain Sequences for d1lqva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqva_ d.19.1.1 (A:) Endothelial protein C receptor {Human (Homo sapiens)} glqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartq sglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsf rperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhis
Timeline for d1lqva_: