Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63671] (5 PDB entries) |
Domain d1lqss2: 1lqs S:101-207 [74197] Other proteins in same PDB: d1lqsl_, d1lqsm_ complexed with human cytomegalovirus IL-10 complexed with nag |
PDB Entry: 1lqs (more details), 2.7 Å
SCOPe Domain Sequences for d1lqss2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqss2 b.1.2.1 (S:101-207) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} evtltvgsvnleihngfilgkiqlprpkmapaqdtyesifshfreyeiairkvpgqftft hkkvkheqfslltsgevgefcvqvkpsvasrsnkgmwskeecisltr
Timeline for d1lqss2:
View in 3D Domains from other chains: (mouse over for more information) d1lqsl_, d1lqsm_, d1lqsr1, d1lqsr2 |