SCOP 1.65: Domain d1lqsm_: 1lqs M:

Lineage for d1lqsm_ (1lqs M:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglments of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Human herpesvirus 5 [TaxId:10359] [74708] (1 PDB entry)

8. Domain d1lqsm_: 1lqs M: [74193]
   Other proteins in same PDB: d1lqsr1, d1lqsr2, d1lqss1, d1lqss2
   complexed with nag; mutant

Details for d1lqsm_

PDB Entry: 1lqs, 2.7 Å

PDB Description: crystal structure of human cytomegalovirus il-10 bound to soluble human il-10r1

SCOP Domain Sequences for d1lqsm_:

Sequence; same for both SEQRES and ATOM records:

>d1lqsm_ a.26.1.3 (M:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human herpesvirus 5}
tkpqcrpedyatrlqdlrvtfhrvkptlqreddysvwldgtvvkgcwgcsvmdwllrryl
eivfpagdhvypglktelhsmrstlesiykdmrqcpllgcgdksvisrlsqeaerksdng
trkglseldtlfsrleeylhsr

Timeline for d1lqsm_:

• d1lqsm_ first appeared in SCOP 1.61
  
• d1lqsm_ appears in SCOP 1.63
  
• d1lqsm_ appears in SCOP 1.67
  
• d1lqsm_ appears in the current release, SCOPe 2.08