SCOPe 2.02: Domain d1lqfd_: 1lqf D:

Lineage for d1lqfd_ (1lqf D:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (97 PDB entries)
   Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299

8. Domain d1lqfd_: 1lqf D: [74190]
   complexed with bgd

Details for d1lqfd_

PDB Entry: 1lqf, 2.5 Å

PDB Description: structure of ptp1b in complex with a peptidic bisphosphonate inhibitor

PDB Compounds: (D:) protein-tyrosine phosphatase, non-receptor type 1

SCOPe Domain Sequences for d1lqfd_:

Sequence; same for both SEQRES and ATOM records:

>d1lqfd_ c.45.1.2 (D:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg

Timeline for d1lqfd_:

• d1lqfd_ first appeared in SCOP 1.61
  
• d1lqfd_ appears in SCOPe 2.01
  
• d1lqfd_ appears in SCOPe 2.03
  
• d1lqfd_ appears in the current release, SCOPe 2.08, called d1lqfd1