Lineage for d1lqfd_ (1lqf D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180719Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 180720Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
  5. 180748Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
  6. 180759Protein Tyrosine phosphatase [52806] (8 species)
  7. 180760Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (32 PDB entries)
  8. 180792Domain d1lqfd_: 1lqf D: [74190]

Details for d1lqfd_

PDB Entry: 1lqf (more details), 2.5 Å

PDB Description: structure of ptp1b in complex with a peptidic bisphosphonate inhibitor

SCOP Domain Sequences for d1lqfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqfd_ c.45.1.2 (D:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg

SCOP Domain Coordinates for d1lqfd_:

Click to download the PDB-style file with coordinates for d1lqfd_.
(The format of our PDB-style files is described here.)

Timeline for d1lqfd_: