Lineage for d1lqfa_ (1lqf A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244631Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432
  4. 244632Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 244660Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 244671Protein Tyrosine phosphatase [52806] (8 species)
  7. 244672Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (33 PDB entries)
  8. 244702Domain d1lqfa_: 1lqf A: [74187]

Details for d1lqfa_

PDB Entry: 1lqf (more details), 2.5 Å

PDB Description: structure of ptp1b in complex with a peptidic bisphosphonate inhibitor
PDB Compounds: (A:)

SCOP Domain Sequences for d1lqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqfa_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg

SCOP Domain Coordinates for d1lqfa_:

Click to download the PDB-style file with coordinates for d1lqfa_.
(The format of our PDB-style files is described here.)

Timeline for d1lqfa_: