![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.3: Spo0A [46903] (1 protein) elaborated with additional helices automatically mapped to Pfam PF08769 |
![]() | Protein Spo0A [46904] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [74692] (1 PDB entry) |
![]() | Domain d1lq1a_: 1lq1 A: [74179] protein/DNA complex |
PDB Entry: 1lq1 (more details), 2.3 Å
SCOPe Domain Sequences for d1lq1a_:
Sequence, based on SEQRES records: (download)
>d1lq1a_ a.4.6.3 (A:) Spo0A {Bacillus subtilis [TaxId: 1423]} kknldasitsiiheigvpahikgylylreaismvyndiellgsitkvlypdiakkfntta srverairhaievawsrgnidsisslfgytvsmtkakptnsefiamvadklrleh
>d1lq1a_ a.4.6.3 (A:) Spo0A {Bacillus subtilis [TaxId: 1423]} kknldasitsiiheigvpahikgylylreaismvyndiellgsitkvlypdiakkfntta srverairhaievawsrgnidsisslfakptnsefiamvadklrleh
Timeline for d1lq1a_: