Lineage for d1loha1 (1loh A:170-540)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284360Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incoplete toroid
  5. 284366Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 284377Protein Hyaluronate lyase [48237] (2 species)
  7. 284382Species Streptococcus pneumoniae [TaxId:1313] [48238] (10 PDB entries)
  8. 284390Domain d1loha1: 1loh A:170-540 [74147]
    Other proteins in same PDB: d1loha2, d1loha3
    complexed with gcu, nag; mutant

Details for d1loha1

PDB Entry: 1loh (more details), 2 Å

PDB Description: streptococcus pneumoniae hyaluronate lyase in complex with hexasaccharide hyaluronan substrate

SCOP Domain Sequences for d1loha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1loha1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgafg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOP Domain Coordinates for d1loha1:

Click to download the PDB-style file with coordinates for d1loha1.
(The format of our PDB-style files is described here.)

Timeline for d1loha1: