Lineage for d1lo4h2 (1lo4 H:119-220)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655633Domain d1lo4h2: 1lo4 H:119-220 [74140]
    Other proteins in same PDB: d1lo4h1, d1lo4l1, d1lo4l2
    part of retro Diels-Alder catalytic Fab 9D9

Details for d1lo4h2

PDB Entry: 1lo4 (more details), 2.4 Å

PDB Description: retro-diels-alderase catalytic antibody 9d9
PDB Compounds: (H:) Ig gamma 2a heavy chain

SCOP Domain Sequences for d1lo4h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo4h2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstqvdkkivpraa

SCOP Domain Coordinates for d1lo4h2:

Click to download the PDB-style file with coordinates for d1lo4h2.
(The format of our PDB-style files is described here.)

Timeline for d1lo4h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lo4h1