Lineage for d1lo3y2 (1lo3 Y:120-221)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549330Domain d1lo3y2: 1lo3 Y:120-221 [74138]
    Other proteins in same PDB: d1lo3h1, d1lo3l1, d1lo3l2, d1lo3x1, d1lo3x2, d1lo3y1

Details for d1lo3y2

PDB Entry: 1lo3 (more details), 2.3 Å

PDB Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue

SCOP Domain Sequences for d1lo3y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo3y2 b.1.1.2 (Y:120-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp

SCOP Domain Coordinates for d1lo3y2:

Click to download the PDB-style file with coordinates for d1lo3y2.
(The format of our PDB-style files is described here.)

Timeline for d1lo3y2: