Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries) Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity |
Domain d1lo3y1: 1lo3 Y:1-119 [74137] Other proteins in same PDB: d1lo3h2, d1lo3l1, d1lo3l2, d1lo3x1, d1lo3x2, d1lo3y2 part of retro Diels-Alder catalytic Fab 9D9 complexed with an1 |
PDB Entry: 1lo3 (more details), 2.3 Å
SCOPe Domain Sequences for d1lo3y1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lo3y1 b.1.1.1 (Y:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa
Timeline for d1lo3y1: