Lineage for d1lo3y1 (1lo3 Y:1-119)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652421Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (16 PDB entries)
  8. 652434Domain d1lo3y1: 1lo3 Y:1-119 [74137]
    Other proteins in same PDB: d1lo3h2, d1lo3l1, d1lo3l2, d1lo3x1, d1lo3x2, d1lo3y2

Details for d1lo3y1

PDB Entry: 1lo3 (more details), 2.3 Å

PDB Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue
PDB Compounds: (Y:) Ig gamma 2a heavy chain

SCOP Domain Sequences for d1lo3y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo3y1 b.1.1.1 (Y:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa

SCOP Domain Coordinates for d1lo3y1:

Click to download the PDB-style file with coordinates for d1lo3y1.
(The format of our PDB-style files is described here.)

Timeline for d1lo3y1: