Lineage for d1lo3y1 (1lo3 Y:1-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740064Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (15 PDB entries)
    Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity
  8. 2740075Domain d1lo3y1: 1lo3 Y:1-119 [74137]
    Other proteins in same PDB: d1lo3h2, d1lo3l1, d1lo3l2, d1lo3x1, d1lo3x2, d1lo3y2
    part of retro Diels-Alder catalytic Fab 9D9
    complexed with an1

Details for d1lo3y1

PDB Entry: 1lo3 (more details), 2.3 Å

PDB Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue
PDB Compounds: (Y:) Ig gamma 2a heavy chain

SCOPe Domain Sequences for d1lo3y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo3y1 b.1.1.1 (Y:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa

SCOPe Domain Coordinates for d1lo3y1:

Click to download the PDB-style file with coordinates for d1lo3y1.
(The format of our PDB-style files is described here.)

Timeline for d1lo3y1: