SCOP 1.61: Domain d1lo3x2: 1lo3 X:113-220

Lineage for d1lo3x2 (1lo3 X:113-220)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74828] (4 PDB entries)
Domain d1lo3x2: 1lo3 X:113-220 [74136]
Other proteins in same PDB: d1lo3h1, d1lo3l1, d1lo3x1, d1lo3y1

Details for d1lo3x2

PDB Entry: 1lo3 (more details), 2.3 Å

PDB Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue

SCOP Domain Sequences for d1lo3x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo3x2 b.1.1.2 (X:113-220) Immunoglobulin (constant domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1lo3x2:

Click to download the PDB-style file with coordinates for d1lo3x2.
(The format of our PDB-style files is described here.)

Timeline for d1lo3x2: