Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries) |
Domain d1lo3h2: 1lo3 H:120-221 [74132] Other proteins in same PDB: d1lo3h1, d1lo3l1, d1lo3l2, d1lo3x1, d1lo3x2, d1lo3y1 part of retro Diels-Alder catalytic Fab 9D9 complexed with an1 |
PDB Entry: 1lo3 (more details), 2.3 Å
SCOP Domain Sequences for d1lo3h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lo3h2 b.1.1.2 (H:120-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp
Timeline for d1lo3h2: