Lineage for d1lo3h2 (1lo3 H:120-221)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365294Domain d1lo3h2: 1lo3 H:120-221 [74132]
    Other proteins in same PDB: d1lo3h1, d1lo3l1, d1lo3l2, d1lo3x1, d1lo3x2, d1lo3y1
    part of retro Diels-Alder catalytic Fab 9D9
    complexed with an1

Details for d1lo3h2

PDB Entry: 1lo3 (more details), 2.3 Å

PDB Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue

SCOP Domain Sequences for d1lo3h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo3h2 b.1.1.2 (H:120-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp

SCOP Domain Coordinates for d1lo3h2:

Click to download the PDB-style file with coordinates for d1lo3h2.
(The format of our PDB-style files is described here.)

Timeline for d1lo3h2: