Lineage for d1lo2y1 (1lo2 Y:1-119)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451081Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (16 PDB entries)
  8. 451089Domain d1lo2y1: 1lo2 Y:1-119 [74129]
    Other proteins in same PDB: d1lo2h2, d1lo2l1, d1lo2l2, d1lo2x1, d1lo2x2, d1lo2y2

Details for d1lo2y1

PDB Entry: 1lo2 (more details), 2 Å

PDB Description: retro-diels-alderase catalytic antibody

SCOP Domain Sequences for d1lo2y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo2y1 b.1.1.1 (Y:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1}
evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa

SCOP Domain Coordinates for d1lo2y1:

Click to download the PDB-style file with coordinates for d1lo2y1.
(The format of our PDB-style files is described here.)

Timeline for d1lo2y1: