Lineage for d1lo0x2 (1lo0 X:113-220)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 160207Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74828] (4 PDB entries)
  8. 160210Domain d1lo0x2: 1lo0 X:113-220 [74120]
    Other proteins in same PDB: d1lo0h1, d1lo0l1, d1lo0x1, d1lo0y1

Details for d1lo0x2

PDB Entry: 1lo0 (more details), 2 Å

PDB Description: Catalytic Retro-Diels-Alderase Transition State Analogue Complex

SCOP Domain Sequences for d1lo0x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo0x2 b.1.1.2 (X:113-220) Immunoglobulin (constant domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1lo0x2:

Click to download the PDB-style file with coordinates for d1lo0x2.
(The format of our PDB-style files is described here.)

Timeline for d1lo0x2: