Lineage for d1lo0h1 (1lo0 H:1-119)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353030Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (15 PDB entries)
    Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity
  8. 2353033Domain d1lo0h1: 1lo0 H:1-119 [74115]
    Other proteins in same PDB: d1lo0h2, d1lo0l1, d1lo0l2, d1lo0x1, d1lo0x2, d1lo0y2
    part of retro Diels-Alder catalytic Fab 9D9
    complexed with bc1

Details for d1lo0h1

PDB Entry: 1lo0 (more details), 2 Å

PDB Description: Catalytic Retro-Diels-Alderase Transition State Analogue Complex
PDB Compounds: (H:) Ig gamma 2a heavy chain

SCOPe Domain Sequences for d1lo0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo0h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa

SCOPe Domain Coordinates for d1lo0h1:

Click to download the PDB-style file with coordinates for d1lo0h1.
(The format of our PDB-style files is described here.)

Timeline for d1lo0h1: