Lineage for d1lnuh2 (1lnu H:1-120)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719844Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 719923Species Mouse (Mus musculus), I-AB [TaxId:10090] [88828] (2 PDB entries)
  8. 719928Domain d1lnuh2: 1lnu H:1-120 [74112]
    Other proteins in same PDB: d1lnua1, d1lnua2, d1lnub1, d1lnuc1, d1lnuc2, d1lnud1, d1lnue1, d1lnue2, d1lnuf1, d1lnug1, d1lnug2, d1lnuh1
    contains covalently bound peptides at the N-termini of chains B, D, F and H
    complexed with nag

Details for d1lnuh2

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide
PDB Compounds: (H:) H-2 class II histocompatibility antigen, A beta chain

SCOP Domain Sequences for d1lnuh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnuh2 d.19.1.1 (H:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-AB [TaxId: 10090]}
feaqkakankavdggggslvprgsggggserhfvyqfmgecyftngtqriryvtryiynr
eeyvrydsdvgehravtelgrpdaeywnsqpeilertraeldtvcrhnyegpethtslrr

SCOP Domain Coordinates for d1lnuh2:

Click to download the PDB-style file with coordinates for d1lnuh2.
(The format of our PDB-style files is described here.)

Timeline for d1lnuh2: