![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (10 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d1lnuh1: 1lnu H:121-217 [74111] Other proteins in same PDB: d1lnua1, d1lnua2, d1lnub2, d1lnuc1, d1lnuc2, d1lnud2, d1lnue1, d1lnue2, d1lnuf2, d1lnug1, d1lnug2, d1lnuh2 contains covalently bound peptides at the N-termini of chains B, D, F and H |
PDB Entry: 1lnu (more details), 2.5 Å
SCOP Domain Sequences for d1lnuh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnuh1 b.1.1.2 (H:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group} leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw tfqvlvmlemtprrgevytchvehpslkspitvewka
Timeline for d1lnuh1: