SCOP 1.67: Domain d1lnuh1: 1lnu H:121-217

Lineage for d1lnuh1 (1lnu H:121-217)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (10 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1lnuh1: 1lnu H:121-217 [74111]
   Other proteins in same PDB: d1lnua1, d1lnua2, d1lnub2, d1lnuc1, d1lnuc2, d1lnud2, d1lnue1, d1lnue2, d1lnuf2, d1lnug1, d1lnug2, d1lnuh2
   contains covalently bound peptides at the N-termini of chains B, D, F and H
   complexed with nag

Details for d1lnuh1

PDB Entry: 1lnu, 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide

SCOP Domain Sequences for d1lnuh1:

Sequence; same for both SEQRES and ATOM records:

>d1lnuh1 b.1.1.2 (H:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewka

Timeline for d1lnuh1:

• d1lnuh1 first appeared in SCOP 1.61
  
• d1lnuh1 appears in SCOP 1.65
  
• d1lnuh1 appears in SCOP 1.69
  
• d1lnuh1 appears in the current release, SCOPe 2.08