Lineage for d1lnug1 (1lnu G:84-182)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364807Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 364852Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 364863Domain d1lnug1: 1lnu G:84-182 [74109]
    Other proteins in same PDB: d1lnua2, d1lnub1, d1lnub2, d1lnuc2, d1lnud1, d1lnud2, d1lnue2, d1lnuf1, d1lnuf2, d1lnug2, d1lnuh1, d1lnuh2
    complexed with nag

Details for d1lnug1

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide

SCOP Domain Sequences for d1lnug1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnug1 b.1.1.2 (G:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrd
ysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOP Domain Coordinates for d1lnug1:

Click to download the PDB-style file with coordinates for d1lnug1.
(The format of our PDB-style files is described here.)

Timeline for d1lnug1: