Lineage for d1lnuf1 (1lnu F:121-217)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784902Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 784971Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 784983Domain d1lnuf1: 1lnu F:121-217 [74107]
    Other proteins in same PDB: d1lnua1, d1lnua2, d1lnub2, d1lnuc1, d1lnuc2, d1lnud2, d1lnue1, d1lnue2, d1lnuf2, d1lnug1, d1lnug2, d1lnuh2
    contains covalently bound peptides at the N-termini of chains B, D, F and H

Details for d1lnuf1

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide
PDB Compounds: (F:) H-2 class II histocompatibility antigen, A beta chain

SCOP Domain Sequences for d1lnuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnuf1 b.1.1.2 (F:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewka

SCOP Domain Coordinates for d1lnuf1:

Click to download the PDB-style file with coordinates for d1lnuf1.
(The format of our PDB-style files is described here.)

Timeline for d1lnuf1: