Lineage for d1lnuf1 (1lnu F:121-217)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220811Species Mouse (Mus musculus), I-AB [TaxId:10090] [74839] (2 PDB entries)
  8. 220819Domain d1lnuf1: 1lnu F:121-217 [74107]
    Other proteins in same PDB: d1lnua2, d1lnub2, d1lnuc2, d1lnud2, d1lnue2, d1lnuf2, d1lnug2, d1lnuh2

Details for d1lnuf1

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide

SCOP Domain Sequences for d1lnuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnuf1 b.1.1.2 (F:121-217) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AB}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewka

SCOP Domain Coordinates for d1lnuf1:

Click to download the PDB-style file with coordinates for d1lnuf1.
(The format of our PDB-style files is described here.)

Timeline for d1lnuf1: