SCOP 1.69: Domain d1lnue1: 1lnu E:84-182

Lineage for d1lnue1 (1lnu E:84-182)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1lnue1: 1lnu E:84-182 [74105]
   Other proteins in same PDB: d1lnua2, d1lnub1, d1lnub2, d1lnuc2, d1lnud1, d1lnud2, d1lnue2, d1lnuf1, d1lnuf2, d1lnug2, d1lnuh1, d1lnuh2

Details for d1lnue1

PDB Entry: 1lnu, 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide

SCOP Domain Sequences for d1lnue1:

Sequence; same for both SEQRES and ATOM records:

>d1lnue1 b.1.1.2 (E:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrd
ysfhklsyltfipsdddiydckvehwgleepvlkhwepe

Timeline for d1lnue1:

• d1lnue1 first appeared in SCOP 1.61
  
• d1lnue1 appears in SCOP 1.67
  
• d1lnue1 appears in SCOP 1.71
  
• d1lnue1 appears in the current release, SCOPe 2.08