Lineage for d1lnud1 (1lnu D:121-217)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453132Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 453182Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 453191Domain d1lnud1: 1lnu D:121-217 [74103]
    Other proteins in same PDB: d1lnua1, d1lnua2, d1lnub2, d1lnuc1, d1lnuc2, d1lnud2, d1lnue1, d1lnue2, d1lnuf2, d1lnug1, d1lnug2, d1lnuh2

Details for d1lnud1

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide
PDB Compounds: (D:)

SCOP Domain Sequences for d1lnud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnud1 b.1.1.2 (D:121-217) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewka

SCOP Domain Coordinates for d1lnud1:

Click to download the PDB-style file with coordinates for d1lnud1.
(The format of our PDB-style files is described here.)

Timeline for d1lnud1: