Lineage for d1lnuc2 (1lnu C:1-83)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326895Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species)
  7. 326941Species Mouse (Mus musculus), I-AB [TaxId:10090] [88815] (2 PDB entries)
  8. 326944Domain d1lnuc2: 1lnu C:1-83 [74102]
    Other proteins in same PDB: d1lnua1, d1lnub1, d1lnub2, d1lnuc1, d1lnud1, d1lnud2, d1lnue1, d1lnuf1, d1lnuf2, d1lnug1, d1lnuh1, d1lnuh2

Details for d1lnuc2

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide

SCOP Domain Sequences for d1lnuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnuc2 d.19.1.1 (C:1-83) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AB}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstpa

SCOP Domain Coordinates for d1lnuc2:

Click to download the PDB-style file with coordinates for d1lnuc2.
(The format of our PDB-style files is described here.)

Timeline for d1lnuc2: