![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
![]() | Species Mouse (Mus musculus), I-AB [TaxId:10090] [74839] (1 PDB entry) |
![]() | Domain d1lnuc1: 1lnu C:84-182 [74101] Other proteins in same PDB: d1lnua2, d1lnub2, d1lnuc2, d1lnud2, d1lnue2, d1lnuf2, d1lnug2, d1lnuh2 |
PDB Entry: 1lnu (more details), 2.5 Å
SCOP Domain Sequences for d1lnuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnuc1 b.1.1.2 (C:84-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AB} tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrd ysfhklsyltfipsdddiydckvehwgleepvlkhwepe
Timeline for d1lnuc1: