Lineage for d1lnqa1 (1lnq A:116-336)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478841Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)
  6. 478852Protein Potassium channel-related protein MthK [75122] (1 species)
    includes extra C-terminal alpha+beta subdomain, residues 261-336
  7. 478853Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (1 PDB entry)
  8. 478854Domain d1lnqa1: 1lnq A:116-336 [74049]
    Other proteins in same PDB: d1lnqa2, d1lnqb2, d1lnqc2, d1lnqd2, d1lnqe2, d1lnqf2, d1lnqg2, d1lnqh2

Details for d1lnqa1

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a

SCOP Domain Sequences for d1lnqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqa1 c.2.1.9 (A:116-336) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiig
vgrgdeliidpprdysfragdiilgigkpeeierlknyisa

SCOP Domain Coordinates for d1lnqa1:

Click to download the PDB-style file with coordinates for d1lnqa1.
(The format of our PDB-style files is described here.)

Timeline for d1lnqa1: